Description
IGF-1 LR3 Peptide
Source: PubChem
CAS Number: 946870-92-4
Molecular Weight: 9117.59 g/mol
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Formula: C400H625N111O115S9
Product Overview
IGF-1 LR3 (Long R3 Insulin-like Growth Factor-1) is a synthetic version of insulin-like growth factor 1, modified to increase stability and half-life. Composed of 83 amino acids, it is designed for scientific research into cell growth, differentiation, and tissue regeneration. Researchers are exploring its potential effects on cellular development in controlled environments.
Key Details:
- Physical Form: Lyophilized powder
- Solubility: Soluble in water
- Purity: ≥98% (by HPLC)
- Storage: Store in a dry, cool place, away from direct sunlight and moisture.
Research Application
IGF-1 LR3 has attracted attention in laboratory research for its potential role in cell proliferation, differentiation, and tissue growth. It is not approved for human consumption and is intended for research purposes only. IGF-1 LR3 has shown promise in controlled research models involving muscle and tissue development.
Disclaimer:
All products sold by Elite Miami Peptides are intended for laboratory research purposes only. They are not for human consumption or clinical use. IGF-1 LR3 is not classified as a prescription drug or dietary supplement, and no health claims are made for this product. This product should not be used in humans or animals.
Compliance Notes:
This product is marketed for research purposes only and complies with all applicable advertising policies. We do not promote or imply the use of this product for human health, therapeutic interventions, or any form of clinical treatment. It is not intended to exploit any personal hardships or difficulties, and no misleading health claims are made.
Reviews
There are no reviews yet.