X

Receive Free Shipping on Purchases Over $200

Cagrilintide (5mg)

Cagrilintide 5mg peptide for sale. This long-acting amylin analog is studied for its potential role in weight loss, appetite suppression, and metabolic regulation. Ideal for advanced research applications.

$74.95

Bulk deal
QuantityDiscountDiscounted price
24%$71.95
38%$68.95
412%$65.96
5 +15%$63.71

Product Details

Cagrilintide (5mg) For Sale

Source: PubChem

  • CAS Number: 1415456-99-3

  • Molecular Weight: 4409 g/mol

  • Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP

  • Formula: C194H312N54O59S2


Product Overview

Cagrilintide is a synthetic analog of amylin, a hormone co-secreted with insulin that plays a role in regulating appetite and gastric emptying. It has been studied for its ability to enhance satiety, reduce caloric intake, and support weight loss. Cagrilintide is often evaluated in combination with GLP-1 receptor agonists for synergistic effects in metabolic research.


Key Details

  • Physical Form: Lyophilized powder

  • Solubility: Soluble in water

  • Purity: ≥98% (by HPLC)

  • Storage: Store in a dry, cool place, away from direct sunlight and moisture.


Disclaimer

All products sold on Elite Miami Peptides are intended for laboratory research purposes only. They are not intended for human consumption, therapeutic use, or clinical treatment. Cagrilintide is not classified as a prescription drug, over-the-counter medication, or dietary supplement and does not make any health claims or guarantees. Elite Miami Peptides does not sell or endorse products intended to treat or cure any diseases.