Cagrilintide (5mg)
Cagrilintide 5mg peptide for sale. This long-acting amylin analog is studied for its potential role in weight loss, appetite suppression, and metabolic regulation. Ideal for advanced research applications.
Discount per Quantity
| Quantity | Discount | Price |
|---|---|---|
| 2 | 5% | $71.20 |
| 3 | 10% | $67.46 |
| 4 | 15% | $63.71 |
| 5 | 20% | $59.96 |
$74.95
Product Details
Cagrilintide (5mg) For Sale
Source: PubChem
CAS Number: 1415456-99-3
Molecular Weight: 4409 g/mol
Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Formula: C194H312N54O59S2
Product Overview
Cagrilintide is a synthetic analog of amylin, a hormone co-secreted with insulin that plays a role in regulating appetite and gastric emptying. It has been studied for its ability to enhance satiety, reduce caloric intake, and support weight loss. Cagrilintide is often evaluated in combination with GLP-1 receptor agonists for synergistic effects in metabolic research.
Key Details
Physical Form: Lyophilized powder
Solubility: Soluble in water
Purity: ≥98% (by HPLC)
Storage: Store in a dry, cool place, away from direct sunlight and moisture.
Disclaimer
All products sold on Elite Miami Peptides are intended for laboratory research purposes only. They are not intended for human consumption, therapeutic use, or clinical treatment. Cagrilintide is not classified as a prescription drug, over-the-counter medication, or dietary supplement and does not make any health claims or guarantees. Elite Miami Peptides does not sell or endorse products intended to treat or cure any diseases.
Discount per Quantity
| Quantity | Discount | Price |
|---|---|---|
| 2 | 5% | $71.20 |
| 3 | 10% | $67.46 |
| 4 | 15% | $63.71 |
| 5 | 20% | $59.96 |
